PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G16840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 332aa    MW: 35550.9 Da    PI: 6.8299
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G16840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.32.2e-15262305548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  LPERR05G16840.1 262 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ 305
                      69***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.6E-15256305No hitNo description
SMARTSM003382.0E-10258314IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702260305IPR004827Basic-leucine zipper domain
PfamPF001702.9E-13262305IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-11262307No hitNo description
CDDcd147078.41E-25262309No hitNo description
PROSITE patternPS000360265280IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MIQAMASHAG GSGSGGGRDA GSAQRMQSLG RQGSLYGLTL NEVQNQLGEP LLSMNLDELL  60
KSVFPDGVDP DGGGGGAAGQ SQPALGLQRE GSITMPPELS KKTVDEVWKG IQDVPKRGGE  120
EGGRRRRERQ PTLGEMTLED FLVKAGVVTD GYLKDSSDLV GNMDVVGGTA AAAGTSDLTA  180
GAQWLQRYQQ QALEPPHPSI AAPYMASHLV PQPLAIATGA VLDPIYSDGQ ITSPMLGALS  240
DPQTPGRKRG ATGEIADKIV ERRQKRMIKN RESAARSRAR KQAYTNELEN KVSRLEEENE  300
RLKKQKELDE ILNSAPPPEP KYQLRRTSSA AF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122129GRRRRERQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0633980.0AK063398.1 Oryza sativa Japonica Group cDNA clone:001-114-H11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638733.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES31e-90AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D9WHZ20.0A0A0D9WHZ2_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g41070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-80ABA-responsive element binding protein 3